Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5li8A_

Fold library idPDB HeaderMoleculeTitle
c5li8A_1.83PDB header: oxidoreductaseChain: A: PDB Molecule: putative cytochrome p450 126;


Added to library: Fri Feb 10 03:21:41 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GLSGIDLTDLDNFADGFPHHLFAIHRREAPVYWHRPTEHTPDGEGFWSVATYAETLEVLRDPVTYSSVTF
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
GGG

TT
GGGTTTS


S


TTSGGG


ST
TTTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence GGTVLQDLPVAGQVLNMMDDPRHTRIRRLVSSGLTPRMIRRVEDDLRRRARGLLDGVEPGAPFDFVVEIA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TT

S

SS



GGG

TTS
T

TT

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence AELPMQMICILLGVPETDRHWLFEAVEPLNVEDAGSRLYTYALELIAGKRAEPADDMLSVVANATIDDPD
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTT

GGG



S

SST




TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence APALSDAELYLFFHLLFSAGAETTRNSIAGGLLALAENPDQLQTLRSDFELLPTAIEEIVRWTSPSPSKR
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) S




T
GGG
SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence RTASRAVSLGGQPIEAGQKVVVWEGSANRDPSVFDRADEFDITRKPNPHLGFGQGVHYCLGANLARLELR
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
S
TT
TT

TT
TTTSTTTTS

TT

S



TT

STT

TT
 .........360.........370.........380.........390
Sequence VLFEELLSRFGSVRVVEPAEWTRSNRHTGIRHLVVELRGG
Predicted secondary structure
























SS confidence







































Known secondary structure (DSSP)
S
S


S
SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D