Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lf5A_

Fold library idPDB HeaderMoleculeTitle
c5lf5A_3.80PDB header: cell adhesionChain: A: PDB Molecule: myelin-associated glycoprotein;


Added to library: Thu Feb 9 22:20:43 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GHWGAWMPSTISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYPPVVFKSRTQVVHESFQGRS
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

S

STTS




TT


SS
S


SSS


TT




TTTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RLLGDLGLRNCTLLLSTLSPELGGKYYFRGDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSC
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
S
GGGT



S

GGG

SSS

S

SS


S
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence MVPDNCPELRPELSWLGHEGLGEPTVLGRLREDEGTWVQVSLLHFVPTREANGHRLGCQAAFPNTTLQFE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


SS


S
TTS

TTT


GGGTT

TTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence GYASLDVKYPPVIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGMVLREAVAKSLYLDLEEVTPGE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)







TTS
SS

BTTB



SSS

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence DGVYACLAENAYGQDNRTVELSVMYAPWKPTVNGTVVAVEGETVSILCSTQSNPDPILTIFKEKQILATV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT






STT




SS


TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence IYESQLQLELPAVTPEDDGEYWCVAENQYGQRATAFNLSVEFAPIILLESHCAAARDTVQCLCVVKSNPE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SS
SSS

GGG


TT





TT

SS

SS
 .........430.........440.........450.........460.........470.........480....
Sequence PSVAFELPSTVNETEREFVYSERSGLLLTSILTIRGQAQAPPRVICTSRNLYGTQSLELPFQGA
Predicted secondary structure






















SS confidence































































Known secondary structure (DSSP)







S


TTTT

SS




SS


B



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D