Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ldwO_

Fold library idPDB HeaderMoleculeTitle
c5ldwO_4.27PDB header: oxidoreductaseChain: O: PDB Molecule: nadh dehydrogenase [ubiquinone] 1 alpha subcomplex subunit


Added to library: Thu Feb 9 11:15:13 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)



SSS

SSTT
STT






SS
SSTTTSS




SSSSSSSSSSSS


TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence XXXXXXXXXXXXXXXXGNSYRLQAWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYRQGFI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SSS

TTTTTT

SSSSSTTSS


S
GGGSSTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RKQCVDHYNQVKKVTICEYLPPHVVVYVDVPVPEVQSRIQKKGNPHEMKITSAYLQDIENAYKGTFLPEM
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
SS


S


S
TSSS
SSS
S

 .........220.........230.........240.........250.........260.........270.........280
Sequence SEKCEVLQYSAWEAQDAEKVVEDIEYLKYDKGPWLDQNDRNLHKLRMLVQDKLEVLNYTSIPVFLPEVTV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT

TTT
S
S


S
TTS

TTT
STTTS
SS

GGG

 .........290.........300.........310....
Sequence GAHQSDQVFQEFTELPGRKYRAGYNEDVGDKWIW
Predicted secondary structure




















SS confidence

































Known secondary structure (DSSP)
SSSSTT
SS

TTT






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D