Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ldwM_

Fold library idPDB HeaderMoleculeTitle
c5ldwM_4.27PDB header: oxidoreductaseChain: M: PDB Molecule: nadh-ubiquinone oxidoreductase chain 4;


Added to library: Thu Feb 9 14:04:26 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KYIIPTIMLMPLTWLSKNNMIWVNSTAHSLLISFTSLLLMNQFGDNSLNFSLLFFSDSLSTPLLILTMWL
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)

TTTTTTS
TT
STT


SS



SSTTS


SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence LPLMLMASQHHLSKENLTRKKLFITMLISLQLFLIMTFTAMELILFYILFEATLVPTLIIITRWGNQTER
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) GGGSSSSSS
S

STTTSS
SSS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LNAGLYFLFYTLAGSLPLLVALIYIQNTVGSLNFLMLQYWVQPVHNSWSNVFMWLACMMAFMVKMPLYGL
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) GGGSS

TTSSS









TTSTTS

SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence HLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMLRITLILNPMTDFMAYPFIMLSLWGMIMTSSICLRQTDL
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP)
TS
SSTTTT

TT
SS

TTTTTT

BT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KSLIAYSSVSHMALVIVAILIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERIHSRTMILARGLQTLL
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) TT

SS
BTTTS


SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence PLMATWWLLASLTNLALPPTINLIGELFVVMSTFSWSNITIILMGVNMVITALYSLYMLIMTQRGKYTYH
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTTTS

SSSS
TTTTT




SS
 .........430.........440.........450.......
Sequence INNISPSFTRENALMSLHILPLLLLTLNPKIILGPLY
Predicted secondary structure










SS confidence




































Known secondary structure (DSSP)



S


STTT

TTT

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D