Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ldwL_

Fold library idPDB HeaderMoleculeTitle
c5ldwL_4.27PDB header: oxidoreductaseChain: L: PDB Molecule: nadh-ubiquinone oxidoreductase chain 5;


Added to library: Thu Feb 9 13:05:42 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NMFSSLSLVTLLLLTMPIMMMSFNTYKPSNYPLYVKTAISYAFITSMIPTMMFIHSGQELIISNWHWLTI
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
TTSSSS

SS
S


S




S
 .........80.........90.........100.........110.........120.........130.........140
Sequence QTLKLSLSFKMDYFSMMFIPVALFVTWSIMEFSMWYMYSDPNINKFFKYLLLFLITMLILVTANNLFQLF
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) SS




STSS
S
TTS

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence IGWEGVGIMSFLLIGWWYGRADANTAALQAILYNRIGDIGFILAMAWFLTNLNTWDLQQIFMLNPSDSNM
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) T
S

SSS
SS
STTSTTSS



STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence PLIGLALAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFYPLTENNKYIQSITLCLG
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TTTTSS
TTTS
TGGGS
TTTTSTTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence AITTLFTAMCALTQNDIKKIIAFSTSSQLGLMMVTIGINQPYLAFLHICTHAFFKAMLFMCSGSIIHSLN
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)


TT
STTSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence DEQDIRKMGGLFKAMPFTTTALIVGSLALTGMPFLTGFYSKDLIIEAANTSYTNAWALLMTLIATSFTAI
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S


TTT



TTT
SSS

TTTTSTTTTSSSSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence YSTRIIFFALLGQPRFPTLVNINENNPLLINSIKRLLIGSLFAGYIISNNIPPTTIPQMTMPYYLKTTAL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTTSSS



SSS





TTTS


S



S
TTTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence IVTILGFILALEISNMTKNLKYHYPSNAFKFSTLLGYFPTIMHRLAPYMNLSMSQKSASSLLDLIWLEAI
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) S
SS



S





SS
S
TTTTTTTTTTTTT




TTTT
 .........570.........580.........590.........600....
Sequence LPKTISLAQMKASTLVTNQKGLIKLYFLSFLITILISMILFNFH
Predicted secondary structure



SS confidence











































Known secondary structure (DSSP) SSTSS
S
TTS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D