Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ldwG_

Fold library idPDB HeaderMoleculeTitle
c5ldwG_4.27PDB header: oxidoreductaseChain: G: PDB Molecule: nadh-ubiquinone oxidoreductase 75 kda subunit,


Added to library: Thu Feb 9 14:15:09 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGW
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TT
TT
BTTTT




SS
SSSS



SS

STT
SS
TTT
B

S

 .........80.........90.........100.........110.........120.........130.........140
Sequence NILTNSEKTKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVK
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
SS
STT



TTTSS
SSS
TS

S















SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence TIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTXXXXXXXX
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)

TTT



STTTSS






SSTT


S
SS





TTGGG
SSTTS

STTSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
SSS



SSSSS



SSSS




SSS

S


STTTSSSSS


S


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) SSS


SS
TTT






S

STTSS





SS



SS
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TTTSS

SS
SSS
S



SS
STTT
S





SS



SS
S





SST
 .........430.........440.........450.........460.........470.........480.........490
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TSSS
TTSSSS






SS
TTSTTTTTS


S

S


SS
 .........500.........510.........520.........530.........540.........550.........560
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) SS
SS
SSSS

SS

SS
S

S




SS
SS

SS
SS
S



TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) T



SSS



SS
SSSS


STTTT



S
TTTTTT
STTT

S


 .........640.........650.........660.........670.........680.....
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure






















































SS confidence






















































Known secondary structure (DSSP)




TTSSSS






S



S
SSS
TTT
SSSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D