Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ldgA_

Fold library idPDB HeaderMoleculeTitle
c5ldgA_1.30PDB header: oxidoreductaseChain: A: PDB Molecule: (-)-isopiperitenone reductase;


Added to library: Fri Feb 10 06:12:18 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARQKLLKELNVSENRLVFHQLDVTDLASVA
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

SS
SSTT
SST

GGG

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFKALQALEAGAKEEPPFKPKANGEMIEKF
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TS

S







TTTT

S





SSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence EGAKDCVVTNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGVLGDEDRLTEERVDEVV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTSSS


GGG
GGG



GGG

 .........220.........230.........240.........250.........260.........270.........280
Sequence EVFLKDIKEGKLEESQWPPHFAAERVSKAALNAYTKIAAKKYPSFRINAICPGYAKTDITFHAGPLSVAE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
TTTTT

SSS
TTS


SB
SGGGTT
SSB
 .........290.........300.........310
Sequence AAQVPVKLALLPDGGPSGCFFPRDKALALY
Predicted secondary structure














SS confidence





























Known secondary structure (DSSP) T

TT


S

T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D