Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lc5n_

Fold library idPDB HeaderMoleculeTitle
c5lc5n_4.35PDB header: oxidoreductaseChain: N: PDB Molecule: nadh-ubiquinone oxidoreductase chain 2;


Added to library: Thu Feb 9 20:58:48 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence THQQKVLRLYKRALRHLESWCIHRDKYRYFACLLRARFDEHKNEKDMVKATQLLREAEEEFWHGQHPQPY
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
TTT

SSS

SSSTTTTTT

S


 .........80.........90.........100.........110.........120.........130.........140
Sequence IFPESPGGTSYERYECYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVXXXXXXXXXXXXX
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

SS
SSSSS
SSTT




GGGSTT

TTTSSSSSSSSS
SSS

 .........150.........160......
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure


SS confidence

























Known secondary structure (DSSP) SS





SSS


S
STTTSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D