Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lc5H_

Fold library idPDB HeaderMoleculeTitle
c5lc5H_4.35PDB header: oxidoreductaseChain: H: PDB Molecule: nadh-ubiquinone oxidoreductase chain 1;


Added to library: Thu Feb 9 18:38:10 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MINILMLIIPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSASMFI
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

TTTTTTTTT


S
SSSSSSTTTTS




SS

SSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LAPIMALGLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISY
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) SGGGSS

SSS
SS

SSTTTSSSSSST
 .........150.........160.........170.........180.........190.........200.........210
Sequence EVTLAIILLSVLLMSGSFTLSTLITTQEQMWLILPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFN
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS
S
TTT
SSS
STTTSTTTGGGGSS
SSSS

TTS
TTS

TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence VEYAAGPFALFFMAEYANIIMMNIFTAILFLGTSHNPHMPELYTINFTIKSLLLTMSFLWIRASYPRFRY
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) SSS
STT

S


SS
S



 .........290.........300.........310...
Sequence DQLMHLLWKNFLPLTLALCMWHVSLPILTSGIP
Predicted secondary structure



SS confidence
































Known secondary structure (DSSP) TTTTSTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D