Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lc5G_

Fold library idPDB HeaderMoleculeTitle
c5lc5G_4.35PDB header: oxidoreductaseChain: G: PDB Molecule: nadh-ubiquinone oxidoreductase 75 kda subunit,


Added to library: Thu Feb 9 11:30:25 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGW
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TT
SS
BTTTT




SS
SSSS



SS

S
BSS
SS
TTT
B

S

 .........80.........90.........100.........110.........120.........130.........140
Sequence NILTNSEKTKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVK
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
B
SS
STT



TTTSS
SSS
TS

S















SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTXXXXXXXX
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)
TTT



STTTSS






SSTT


S
SS





TTGGG
SSTT
SSSTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
SSS




SSSS



SSSS





SSS
SS


STTSSSSSS


S


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) SSS


TS
TTT




S

STSS


B

SS



SS
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TTTSS
TT

SS
S



SS

SS



SS



SS
S



SST
 .........430.........440.........450.........460.........470.........480.........490
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) SSSS
TTTTSS







SS
STSTTTTTS

SS

S


SSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) SSS
SS
TTTSSS
S

SS

SSSS
SS



SS



SS
SS
S


TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TS

SSS


SS

SSS


STTTT





TTSTTT
STTT
SS


 .........640.........650.........660.........670.........680.....
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure






















































SS confidence






















































Known secondary structure (DSSP)




TTTS
TT



S



S
SSS
TTT

SSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D