Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lc5F_

Fold library idPDB HeaderMoleculeTitle
c5lc5F_4.35PDB header: oxidoreductaseChain: F: PDB Molecule: nadh dehydrogenase [ubiquinone] flavoprotein 1,


Added to library: Thu Feb 9 11:28:19 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRGRGGAGFPTGLKWSFMN
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





SS

SS


SS
SSTTSSTTS
T
B

STT

BTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
SS
SS



S

SSS

TTT
TTTTTT
S
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence REAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVA
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TSSSTTGGG
SS



SSSTTTSTS
S



TTT

TTT
SSSS


 .........220.........230.........240.........250.........260.........270.........280
Sequence NVETVAVSPTICRRGGAWFASFGRERNSGTKLFNISGHVNNPCTVEEEMSVPLKELIEKHAGGVTGGWDN
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTS
SSB
SS
BS
SSBSS
SS
B
BSS
SSSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LLAVIPGGSSTPLIPKSVCETVLMDFDALIQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)



BSSSSSS



SSSSSS
BSSTTSSS

SS

BB


SSS


S
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence PCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQQF
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTT
S
TTTTS
SSTTTTTTTSS
S
 .....
Sequence AQQHQ
Predicted secondary structure

SS confidence




Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D