Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l9wB_

Fold library idPDB HeaderMoleculeTitle
c5l9wB_2.90PDB header: ligaseChain: B: PDB Molecule: acetophenone carboxylase gamma subunit;


Added to library: Thu Feb 9 23:48:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DAINSIDIDVGGTFTDFVLTLDGERHIAKCPTTPHDLSIGFLNAVEAGGDKVGLSVEELLPRIDIIRYST
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)




SSTT

TT
TTT

GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence TVALNRLLQRQGPRIGLLTTEGHEDAILIGRGAQWTDGQRVAERRNIAVQNKPLPLIERDLILGVRERID
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) STT
S

TT
TTTTTTGGGTT

GGGGS
GGG





SS
STTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence SSGSVVRPLDEEDVRTKLRMLMDRGARAIVVSLLWSFMNPAHEKRVREIIREEYKEYHIGFVPVVMSHSV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTS



TT
S
TTTTT
TS
TTSSS


 .........220.........230.........240.........250.........260.........270.........280
Sequence VSKIGEYERTMTAVLDAYLQRSMQNDIGATWDKLRAKGYHGAFLMIHNSGGSADIFKTPASRTFNGGPVA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


S
TT

S
TTSSGGG

GGGTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence GLMGSAYFANKLGYKNVVAGDVGGTSFDVALVVESSVRNYTFRPVIDKWMVNVTMMQTISVGSGGGSIAK
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TT
S

SS

SSGGGTSBSS
TT



B




TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence VDRSGTRLEVGPRSAGSMPGPVCYDLGGTEPTVTDADVVLGYINPDTYYGGRMPLNKAKAEKAIREKIAQ
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TTS


TTTT
SGGG
SS

S
BTT
S
SSS
TTS




TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence PLGIETIEAAALIRYIVDENMASAIKREVHMRGYHPEDFVLFAFGGAGPTHMAGLKGDIPKAVVFPAAPV
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TTT

TT

GGG
SSSTTT
S
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence FCAMGSSIMDIVHMYEQSRRMVFMEPGTEKFVVDYEHFNQTVDTMIERARQELRSEGLEVDDASFGLELD
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)


TTT

B


TT

GGG
 .........570.........580.........590.........600.........610.........620.........630
Sequence MLYGGQVNLKRMSSPLLHIRTAEDALKVYQAFETEFSEAFSPLVVNKPGGVFLDNFVLRVTVPTWKPPIP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT

S

S
S


SS
GGG

GGG








 .........640.........650.........660.........670.........680.........690.........700
Sequence EYPLQGTDPSAAFLGKRKAYWPETKHWADTPTYQFELLQAGNVIDGPAIVEAELTTIVVPPRQRLSIDTH
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)





S

GGGTTTTGGG

TT

SS
SS

TT
TT
 .........710.
Sequence GLAILEAIDPA
Predicted secondary structure





SS confidence










Known secondary structure (DSSP) S
SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D