Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l9wA_

Fold library idPDB HeaderMoleculeTitle
c5l9wA_2.90PDB header: ligaseChain: A: PDB Molecule: acetophenone carboxylase delta subunit;


Added to library: Thu Feb 9 19:46:53 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AIPTLEQKLTWLKPAPASSRELDLAAQIDPAQFEIGFQRTNDILDEGMDVFVRSCRCAMGVAGDSLVAIM
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)



S




T

TTSSGGGSSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TADGDIVNGSCGTYLHAVIPPLIIKYILETYGDEIRDGDLWFANDAVYGGVHNPDQMVCMPVYYEGKLVA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT

S
STTSSSTGGG

TT


TTTSSS
TTSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence WTAALVHTTETGAIEPGGMPVSATTRFEEGMNLPPMRIGENFKLREDVVSMFVAFGLRAPSMIAVDLKAR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

S

S
SSTTSS
TT

BGGGS




STT
TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence CTTADRVRTRIIELCEREGADYVTGLFRKMLQVAEAGARELIEQWPDGKYRCVTFSDAVGLKQGLVRSCY
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)
TS
STT
 .........290.........300.........310.........320.........330.........340.........350
Sequence MTLEKKGDRMLVDLSETGPETPSPYNAHPQAAIAHFSNYIYEYLFHSLPISNGTFANIDFKFGKNTCLSP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTTT

B

SSS



TSTTS
SSGGGGTT
SSBTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence DPRAATSCSVMISTGVMSAVHNACAKAMFSTSLWKQSGASMGNGGNALVLAGQNQWGSSFADMLAYSINT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTB

TTTTTTTTGGG











TTS
SGGGSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence EGQGARPTEDGMDAFGFPWCVFGRAPNTESVENEFPLLVPLSNHWKDSCGHGKYRGGVGTAQVWVAHHVP
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) B



BTTB


TT
B
SSSTT




SS


TT
S

SSB




SSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence ELYMMAIADNTKLQTPQPLFGGYAPCTVPGIGIRNANIKELMAEGSDKIKLDVETLLAERTIDGKYEIEF
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)



SSS
SS

BSS







T

TT
TT



TT
S
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence QGRSVRPYSNGEVVTFAFSCGGTGYGDPLDRDPKSVEVDLLKGVLTEQTAQNIYKVKWDANLRRVDLDET
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
TTS





BS
GGGS
TSS





TTSSS

S
 .........640.........650.........660.........670.........680...
Sequence SRLRAAEHDARRKRGVPYEQFEREWLKQRPDDEILKYYGTWPDAKVAQPLLRA
Predicted secondary structure




















SS confidence




















































Known secondary structure (DSSP)


TT



TGGGSSS
STTT


SS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D