Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l9uA_

Fold library idPDB HeaderMoleculeTitle
c5l9uA_6.40PDB header: signaling proteinChain: A: PDB Molecule: anaphase-promoting complex subunit 1;


Added to library: Fri Feb 10 00:19:28 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MIAARDLQEFVPFGRDHCKHHPESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKAVYKAFTVDSPVQQA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)







S





B



SS






B



SSS
TTT

SS

S

 .........80.........90.........100.........110.........120.........130.........140
Sequence LWCDFIIEVEKCICILQSSCINMHSIEGKDYIASLPFQVANVWPTKYGLLFERSPLPTMFSMLHPLDEIT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTTTTTTTS


SS

S

TT

SS

SSTTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence PLVCKVQYVVDHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSVPELCIDHLWTNSQASKVFITSDL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
B
SSSB


SS
SSS
TTTTB


SSSSSS
B





S

SB

T
 .........220.........230.........240.........250.........260.........270.........280
Sequence CGQKFLCFLVESQLQLRCVKFQESTQLIFGSVTNIPAKDAAPVEKIDTMLVLEGSGNLVLYTGVVRVGKV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TTTTTTSSS


S
SSSS
TTTSSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence FIPGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
S




TT
TTS



S

SS
SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence YHSEWNLFVTCLMNMMGYDDDWEYLLNSDYHQNVESHLTHIPAIFFVLHLVYEELKLNTLMGEGICSLVE
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) SS
TTS




SSSS





SSTSTT
TTTTTSSST
 .........430.........440.........450.........460.........470.........480.........490
Sequence LLVQLARDLKLGPYVDHYYRDYPTLSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTT

S
STSTT


SS

S

S





TTTTTSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence SLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPASDWPEAVCLLIGRQDLSKQDDGMNDMN
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SSS

TTGGGGS
S

S


TT


S




SSS


 .........570.........580.........590.........600.........610.........620.........630
Sequence HEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLF
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTS
SS



SS








TTS
TTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence SYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVY
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
B


SSS









SSS

TTSSSS


SS
TTTTB
TTS


 .........710.........720.........730.........740.........750.........760.........770
Sequence NKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T


SSTTTGGGGS
TS

SSSS

 .........780.........790.........800.........810.........820.........830.........840
Sequence HIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) STTTS
SS






TSTT

SS



SSSSS
SS
 .........850.........860.........870.........880.........890.........900.........910
Sequence ALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNNRSI
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT

S

SSGGGS
SS





SS



TT

TTT


 .........920.........930.........940.........950.........960.........970.........980
Sequence ADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENLNLETLSQAHVYIIAG
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS


STTS
STTT


SSTS
S

SS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence ACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQ
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TSSS

TSTTTTTT
TT
SS

S
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence LCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T

SSS

TGGGGT


TS
S


SSTT

TTS
GGGG
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence HLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GGGGTT

BTTT
SB




SSSS

SSB

S
SSS
STT


 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence IDLTQHLKSILSKDGVLYVKLRASFAEYFCKFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SSSTTT






SSS
S

SSS
STT





 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence ELWQIKLVLEFFSSRSHQFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSLEESQLSMLACFLVYHS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TSSS




STTTSS

SSS
 .........1340..
Sequence VPSTSFAELLFK
Predicted secondary structure




SS confidence











Known secondary structure (DSSP) S

SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D