Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l9pA_

Fold library idPDB HeaderMoleculeTitle
c5l9pA_2.54PDB header: transport proteinChain: A: PDB Molecule: periplasmic binding protein;


Added to library: Fri Feb 10 00:37:12 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SHHHHHHSSGLVPRGSHMDVVIASSGGGWQEAQDKALWAPAAKALNITYTQDTFQNWAEARAQVESGSVT
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

S
S







SS
TT


TT


S
TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence WDIIQIGIADEPQAKAAGVLEKLDPDIVNKADFPPGSVTDSFVANSNYSTLIAWNKKTYGDNGPKSMADF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SGGGTT



GGG

GGGS
TTS
BTTBTT



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence FDVKKFPGKRALWNQPIGMIEAAALALGTPRDKVYEFLSTEEGRKAAIAKLTELAPSVSVWWESGAQAAQ
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T
TTTS
S
SS
TTTT

GGGTTSGGG

 .........220.........230.........240.........250.........260.........270.........280
Sequence LIKDGEVDMIITWGGRVQGAINDGANFAYTFNDAQLGTDGYAIVKGAPHRDAAMRFLKEMSKAEYQKDLP
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T

STT

TT
TTTSTT
 .........290.........300.........310.........320.........330.........340
Sequence NSFATAPANMKAYDLAKYTPEKMATMASAPENVAVQYSVDPNFWAKHAKWASEAYDNVRL
Predicted secondary structure




















SS confidence



























































Known secondary structure (DSSP) SS
S
TT


TT
TTSTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D