Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l90B_

Fold library idPDB HeaderMoleculeTitle
c5l90B_2.55PDB header: oxidoreductaseChain: B: PDB Molecule: cytochrome p450;


Added to library: Thu Feb 9 17:23:24 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ERFNPFSWYEEMRNTAPVQWDEERQVWDVFHYDGVKEVLEQKNIFSSDRRPPQNQRQTALGTSLINIDPP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

S
T
STTTT
S
TTT





TTS


GGGGSGGG

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KHAEMRALVNKAFTPKAMKAWEPKIARITNELLQEVEHLEDIDIVEHLSYPLPVMVIADILGVPIEDQRQ
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) GGGSSTTT
STTTT

GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence FKDWSDIIVAGPSNNERETLEKLQQEKMKANDELETYFYRIIEEKRTRPGDDIISVLLQAKEEGKQLTDE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) T


SS

SS

SS

BTTB


 .........220.........230.........240.........250.........260.........270.........280
Sequence EIVGFSILLLIAGNETTTNLISNTIYCLMEDKASFERLKREKELLPSGIEEVLRYRSPVQALHRIVKEDV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

GGGS
SB



SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence TLAGKKLKAGEHVVPWMGSAHRDAEYFEDPEVFKIDRKPNVHMAFGRGIHFCLGAPLARIEAKIMLAELI
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT
TT

TT
TTTSSSTTS

TT
SS



TTB
SSSB
TT
 .........360.........370.........380.....
Sequence DRYPQMDWSPSFELKPIESTFVYGLKELLIRKNVH
Predicted secondary structure


























SS confidence


































Known secondary structure (DSSP)
TT

TT



B
S
SSB

BS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D