Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l8sD_

Fold library idPDB HeaderMoleculeTitle
c5l8sD_2.50PDB header: hydrolaseChain: D: PDB Molecule: amino acyl peptidase;


Added to library: Thu Feb 9 15:53:33 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MINFPKPTVEQFFRTYTITNFAVSSDEKRLVFNANLNGKMNLWAMDLPDTYPYLFAHRDESCNFIKFDPE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)







GGGGSS



TTSS

TTSS

TT






S

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence NRYVLAGFDKDGDENYQIYAIPNEGGLPHPLITGDASEKYYFSHLSADGKCVYYETSKENPSFLNTRIRN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SS

STT




TT
B




TT


TTS
STT
TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LETGEDRLLNVGEVSTTELAAVSENEESFVYLRAFANTYIVGFVKMGEETFNITPDPEKVHVAMEPVFTD
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTT



SS
TTS
TTTTSSS
TTS

B
 .........220.........230.........240.........250.........260.........270.........280
Sequence NETIYFATDYDSDEMYLAKFDLTSKEFSKVLAFDGESIQSVKWDKDNKAFYLITVKGVTDILYRYDVATD
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) TT
TTSSS
TTTT
BTTBGGGTTTTTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KVEECSLPVDIIEQIQVAKSGNLYILGRSATVPHNVYQSSNGVEWKQLTNNRVLGLSPEDMVEPDIVSYT
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)


SSS
TTS
TTSSSSS






TT

GGGS


 .........360.........370.........380.........390.........400.........410.........420
Sequence SFDGMEIEALLFKAKPENDNGYTIFWPHGGPQSAERKMFRSMFQCFINRGYTIFAPNFRGSTGYGSAFTK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTS



TTT

S



S
SSS


S


T


TT
SSS
G
 .........430.........440.........450.........460.........470.........480.........490
Sequence LVELDWGEGPRLDCIAGIEWLFESGFTDRNKLFLVGGSYGGYMALLLHGRHSDYFRAVVDIFGPSDLFTF
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) GGTT
SSSTSS
TT
TGGG
S
S



 .........500.........510.........520.........530.........540.........550.........560
Sequence INSVPPHWKPIMERWLGDPERDKERFIKDSPVTYLDGMVKPMLVIQGAKDPRVVKEESDQIVAKLKEKGR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S
GGGT

TTTTT
GGGGGGG

S
TT
SSS
TT
 .........570.........580.........590.........600....
Sequence DVEYLVLEDEGHGFSKKENEIKVYSLMLAFLEKHQALEHHHHHH
Predicted secondary structure



















SS confidence











































Known secondary structure (DSSP)
TT
SSS

STS









Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D