Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l7jA_

Fold library idPDB HeaderMoleculeTitle
c5l7jA_2.15PDB header: translationChain: A: PDB Molecule: elp3 family;


Added to library: Thu Feb 9 14:19:25 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TISGVTPVAVXTKPLPCPGKCIYCPTFAATPQSYTPESPAVLRAKSCEYQAYKQVALRLRIIQDXGHPTD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)










SS

SSS
SS


GGGGSTT
TTT
T


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence KVELIIXGGTFLSADITYQYGFIKDCYDALNGVVAGSLEEAKTINETAQHRCVGLCIETRPDICGKAEIQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
GGGS
SS

SSTTSSS
TTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence RXIDFGTTRVELGVQXLDDDIYKLVERGHRVSDVAEATCLLREYGLKVHYHWXPGLPGSSPEKDLALSRX
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T

SS
TTS

SSSS


TT

TT
TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence VFEDPRFCPDGLKLYPTXVVEGTILEQWWKEGRYTPYPNGTXTGLIADIKALVPPYVRISRVKCRCIRCR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTT
TT


S





TTSTS




T

TT




SSGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence EYSGEPTLRRLDYPASGGKEIFLSFEDASDTLYGLLRLRIPCASLPVLGQKYGAKTGLVRELHVYGTELS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)





TT
TT


SS

S


SSS
SSTTB


 .........360.........370.........380.........390.........400......
Sequence LGHRGLGRKLLAEAECLARDEFGLDSLAILSGVGAREYYRSLGYELVAGYXCKHLD
Predicted secondary structure























SS confidence























































Known secondary structure (DSSP)



TS

S


GGGTTT
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D