Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l53A_

Fold library idPDB HeaderMoleculeTitle
c5l53A_2.24PDB header: oxidoreductaseChain: A: PDB Molecule: (-)-menthone:(+)-neomenthol reductase;


Added to library: Fri Feb 10 01:40:44 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ATKRYAVVTGANKGIGFEICKQLASKGITVILASRDEKRGIEARERLIKELGSEFGDYVVSQQLDVADPA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)



SS
SSTT
SS
GGGGGG

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SVAALVDFIKTKFGSLDILVNNAGLNGTYMEGDASVLNDYVEAEFKTFQSGAAKTEPYHPKATGRLVETV
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TS







S

GGG




S




SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence EHAKECIETNYYGSKRVTEALIPLLQQSDSPRIVNVSSTLSSLVFQTNEWAKGVFSSEEGLTEEKLEEVL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTTSSS


GGGSGGG



SSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence AEFLKDFIDGKQQEKQWPPHFSAYKVSKAALNAYTRIIAKKYPSFRINAVCPTDAEAAEAPVKLALLPQG
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
TTTTT

SSS
TTS

T

TT
 .........290....
Sequence GPSGCFFFRDEAFC
Predicted secondary structure











SS confidence













Known secondary structure (DSSP) S
SS
TTB



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D