Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l4kZ_

Fold library idPDB HeaderMoleculeTitle
c5l4kZ_4.50PDB header: structural proteinChain: Z: PDB Molecule: 26s proteasome non-atpase regulatory subunit 2;


Added to library: Thu Feb 9 17:06:29 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLVERLGEKDTSL
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)

SSS

S
TT

SSTTTTTTTTT




S

SSSTTTTTTTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence YRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERECL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SSTTTTT

SSSTTTS


SSSSTSS
SS
SSSTTTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQREPLLTLVKEIVPYNMAHNAEHEACDLLME
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) SSS


SS

SS

SSSSSSSSTTGGGTSSTTTTSSS

TTGGGSTTT
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence IEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVED
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTSTTTTTTTTTTTS
TTSS

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence IFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTSS
SSS
BS

TTT
S
TTSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence THLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T








STTSTTT


STTTT

GGGTS
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYA
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TTTTTSS
TTTT

SSSS
GGGTSSS

SSTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence GSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SS

TTS

SSSS

STTTS




TTT


S
 .........570.........580.........590.........600.........610.........620.........630
Sequence GLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKD
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) T
S
SSS
SSSTTS

SSSTT
SS

SSGGG


TTTTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence KKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SS
SSTT
SS

S

SGGG
 .........710.........720.........730.........740.........750.........760.........770
Sequence NPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTH
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) SS
ST
SS
SSS


SSS

GGG
B


S

SS
S
 .........780.........790.........800.........810.........820.........830.........840
Sequence LGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMSVRVGQAVDVVGQAG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
B
S

S
TT

TTS


B
S


SSS
S

B





SSS


SSS
 .........850.........860.........870.........880.
Sequence KPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFV
Predicted secondary structure























SS confidence








































Known secondary structure (DSSP) TT


TTTT

SS

S
S
TT


B




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D