Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l2rA_

Fold library idPDB HeaderMoleculeTitle
c5l2rA_2.05PDB header: lyaseChain: A: PDB Molecule: fumarate hydratase;


Added to library: Thu Feb 9 23:17:57 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DFHFSAIFQPTDPHHHQTEFAKVEGSEKYVEEVEVFGRQALKVNPEALTILAHRAFSDVHHFFRKDHLEG
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)





S


SSTT
TTS

TTGGGGTT
TTTT
B
 .........80.........90.........100.........110.........120.........130.........140
Sequence WRRAIEDPEASDNDRYVATTLLKNACIAAGRVLPSCQDTGTAIVLGKRGELCWTGGEDEKYLSKGIWNAY
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
TTS
TTSSS
SSS


TT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence RYHNLRYSQTAALDMFKECNTGDNLPAQLDLLAVPGSDYEFLFIAKGGGSANKAYLYQETKALLNPKSLR
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) SSS




SSSS

SSS


SSS

T
GGG
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence AFIEEKLKTLGTAACPPYHIALVIGGTSAEMTMKTVKLASCRYYDSLPTTGDKYGRAFRDPEWEKIVMEV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTTT
SS

SSTTTTTTS
SS

TT



 .........290.........300.........310.........320.........330.........340.........350
Sequence AQKSGIGAQFGGKYFAHQARVIRLPRHGASCPVGLAVSCSADRQILAHINKSGIYIEQLEQNPAQYLPTS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T
BTTTTSBSTT



TT

SS

TT

BS
GGGG



 .........360.........370.........380.........390.........400.........410.........420
Sequence VKVDLKRPIDKVRQQLSQYPVGTRVMLNGTLIVARDIAHAKIKEMMDNGEPLPEYMKTSPIYYAGPAKTP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
SS
TTS
TT


TT



GGGTSS

B





 .........430.........440.........450.........460.........470.........480.........490
Sequence EGYASGSFGPTTAGRMDSYVDLFQSHGGSYITLAKGNRSKQVTDACKKHGGFYLGSIGGPAAILAKDSIK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT
S
S


B
BGGGGTT

SBS


T

SS
T
 .........500.........510.........520.........530..
Sequence QVTCLAFPELGMEAVWKIEVEDFPAFIVVDDKGNDMYSKTLA
Predicted secondary structure
















SS confidence









































Known secondary structure (DSSP)
TTSSTTS
SSS
BTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D