Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l2eB_

Fold library idPDB HeaderMoleculeTitle
c5l2eB_4.15PDB header: protein bindingChain: B: PDB Molecule: glutamate receptor ionotropic, delta-2,glutamate receptor


Added to library: Sat Feb 11 00:53:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQTEKITFSVTFVDGNNPFQAVQEACELMNQGILAL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)


TT

SSSSTT


TT


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence VSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLNEVILRVVTEY
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
T



GGG










TTS



S



T
 .........150.........160.........170.........180.........190.........200.........210
Sequence AWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILV
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) T


TT

GGGGTT


S
S
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence MNPATAKSFISEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNH
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S
TTSS
TT

S




S





SSGGGSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence RISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLQDRKWHSMASLSCIRKNSKPWQGGRSMLETI
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


TTST

TT








SSSTT



TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence KKGGVNGLTGDLEFGENGGNPNVHFEILGTGVRKLGCWNPVTGLNGSLGVVLRVVTVLEEPFVMVSENVL
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) T

SSS

TTSB







TTTS





BTTTB

T
 .........430.........440.........450.........460.........470.........480.........490
Sequence GKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TS

S


TT




B
TTS
B
TTS
S

 .........500.........510.........520.........530.........540.........550.........560
Sequence NVVDFTTRYMDYSVGVLLRRSIQSLQDLSKQTDIPYGTVLDSAVYQHVRMKGLNPSMYSQMWRMINNNVL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


S




STT

SS


TTS








 .........570.........580.........590.........600.........610.........620.........630
Sequence ESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTVGNTVADRGYGIALQHGSPYRDVFSQRILELQQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TTSSS
T
TT






STT
TT
 .........640........
Sequence SGDMDILKHKWWPKNGQC
Predicted secondary structure









SS confidence

















Known secondary structure (DSSP) TTS

SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D