Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5l1sA_

Fold library idPDB HeaderMoleculeTitle
c5l1sA_2.08PDB header: oxidoreductaseChain: A: PDB Molecule: pentalenolactone synthase;


Added to library: Thu Feb 9 17:06:52 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TDLPRLPFDNPDIMGIAPQMLALQKEGPIARVGTAGEDAWLVTRYDEVRTLLADRRLRLSNPNPQPSAKS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



BSS


SSSBS


SB
SSS

ST
TTSS


SS




 .........80.........90.........100.........110.........120.........130.........140
Sequence AARAFMVALMAGDDHETEPARHAQMRSLLIPRFSTRRLRLMKTRIEHHVDELLDQLAASAPPVDLHRVLS
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT
S
TTTGGGG
S
SSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence FRLPTMVVCDLLGVPLADRERFGQWARGTFDQSDNEHSANTFQQVVDYMLELVARKRVEPGDDILSELIA
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TT

TTTTTBTT
S

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence EKDGALSDADIAHLGNAVLLLGYETTIVRIDLGTLLLLRNPVQRAQLAEDPGLAPAAVEEILRLGVGGKG
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) GGGTTS
SS

GGG

BTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence SNALIPRYAHGDITVGETVIRTGDAVMLAIGAANYDDRAFPDGGLFDLTRVRPRSHLAFGHGARHCIGRT
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) GGG
SS
TT
TT

T
TTTSSSTTS

TT
SS



STT

GGG

TT
 .........360.........370.........380.........390.......
Sequence LARIELTAVFERLFRRLPDLRLAVPEESLRWQEHRITGGFDEIPVTF
Predicted secondary structure


























SS confidence














































Known secondary structure (DSSP)
TT
SS
GGG

B
TTBTT

BS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D