Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5kzqA_

Fold library idPDB HeaderMoleculeTitle
c5kzqA_2.80PDB header: signaling proteinChain: A: PDB Molecule: metabotropic glutamate receptor 2;


Added to library: Thu Feb 9 16:43:25 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KVLTLEGDLVLGGLFPVHQKPAEDCGPVNEHRGIQRLEAMLFALDRINRDPHLLPGVRLGAHILDSCSKD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



S

B




S

SB
TTTT
TTS
SS


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence THALEQALDFVRASLPTAITGVIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPP
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT




SSGGGT

SS


GGGG
TTT
TTSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence DFFQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFELEARARNICVATSEKVGRAMSRAAFEGVVRAL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TT

SSTTT

TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence LQKPSARVAVLFTRSEDARELLAASQRLNASFTWVASDGWGALESVVAGSEGAAEGAITIELASYPISDF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TSTT



TT



TTTTT
TTTSSS
TT





TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence ASYFQSLDPWNNSRNPWFREFWEQRFRCSFRQRDCAAHSLRAVPFEQESKIMFVVNAVYAMAHALHNMHR
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T

TTT

SSTTTT

STTSTTTT

TTTS




TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence ALCPNTTRLCDAMRPVNGRRLYKDFVLNVKFDAPFRPADTHNEVRFDRFGDGIGRYNIFTYLRAGGRYRY
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
SS
SS

GGGSS

TTTT

TT

SS


B
TT

B






 .........430.........440.........450.........460.........470.........480.........490
Sequence QKVGYWAEGLTLDTSLIPWASPSAGPLPASRCSEPCLQNEVKSVQPGEVCCWLCIPCQPYEYRLDEFTCA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SSS
GGGSTTTTT

SS




S




TT
SS
TT


TTSSSS
 .........500...
Sequence DCGLGYWPNASLT
Predicted secondary structure











SS confidence












Known secondary structure (DSSP)

SS



TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D