Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5kxiA_

Fold library idPDB HeaderMoleculeTitle
c5kxiA_3.94PDB header: transport proteinChain: A: PDB Molecule: neuronal acetylcholine receptor subunit alpha-4;


Added to library: Thu Feb 9 12:32:34 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TSS

TTS


SSSS

TTTT
GGG


TG
 .........80.........90.........100.........110.........120.........130.........140
Sequence DYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQ
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) GGTT


GGGS




TTB
SS

S
SS


TTS






SSSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence NCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
SS

TTTS
SB
B
TT



SS
TTSSS
T
 .........220.........230.........240.........250.........260.........270.........280
Sequence LFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFT
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTS
GGGS
TTS


SSS

 .........290.........300.........310.........320.........330.........340.........350
Sequence MIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLERSVKEDWKYVAMVIDRIFLWMFIIV
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)

TT



TTT

 .........360...
Sequence CLLGTVGLFLPPW
Predicted secondary structure



SS confidence












Known secondary structure (DSSP) STTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D