Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5kx6A_

Fold library idPDB HeaderMoleculeTitle
c5kx6A_2.20PDB header: cell adhesionChain: A: PDB Molecule: galactoside 2-alpha-l-fucosyltransferase;


Added to library: Thu Feb 9 13:37:49 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DKLLGGLLASGFDEDSCLSRYQSVHYRKPSPYKPSSYLISKLRNYEKLHKRCGPGTESYKKALKQLDQEG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TTTTTTS
TT

TTT
GGGTS


S




TTSTTT


 .........80.........90.........100.........110.........120.........130.........140
Sequence ECKYVVWISFSGLGNRILSLASVFLYALLTDRVLLVDRGKDMDDLFCEPFLGMSWLLPLDFPMTDQFDGL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





S
TT


TTTB


STTS

B

TT
GGGGGTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence NQESSRCYGYMVKNQVTLSHLYLHLVHDYGDHDKMFFCEGDQTFIGKVPWLIVKTDNYFVPSLWLIPGFD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) STTSTTBTT


SSTT

TTTGGGGSTT
S
S

TTSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence DELNKLFPQKATVFHHLGRYLFHPTNQVWGLVTRYYEAYLSHADEKIGIQVKVFDEDPGPFQHVMDQISS
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
SSGGG

B
TTT
S



SSS



 .........290.........300.........310.........320.........330.........340.........350
Sequence CTQKEKLLPEVDTLVTPKHKAVLVTSLNAGYAENLKSMYWEYPTSTGEIIGVHQPSQEGMHNGKALAEMY
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTSS

B
S





SSSS
BTT








 .........360.........370.........380.........390.........400.........410.........420
Sequence LLSLTDNLVTSAWSTFGYVAQGLGGLKPWILYRPENRTTPDPSCGRAMSMEPCFHSPPFYDCKAKTGIDT
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TSSTT
T





BTTB

SS

S
S


BSS


TTTT

G
 .........430.........440
Sequence GTLVPHVRHCEDISWGLKLV
Predicted secondary structure















SS confidence



















Known secondary structure (DSSP) GGSBTT
SSSTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D