Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5kuhB_

Fold library idPDB HeaderMoleculeTitle
c5kuhB_11.60PDB header: signaling proteinChain: B: PDB Molecule: glutamate receptor ionotropic, kainate 2;


Added to library: Thu Feb 9 15:34:30 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence THVLRFGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
SSS
S


SSSSSSTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence VAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
S


SSTT


S




TT



S
TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence TVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQA
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) SSTTTGGGTSS


SSGGGGTT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence LAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMERLQAPPKPDSGLL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT

STT


TTGGGB

TTTTTS


S
TTSTTS


SSS
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence DGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT


T
TT






TTS



TT
TT

TTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCID
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)



TTTTT









BTTTB


SS


GGGGS
 .........430.........440.........450.........460.........470.........480.........490
Sequence LLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLTITYVREKVIDFSKPFMT
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) T


TTS



B
TTT

B
TTS
S

TT
S
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence LGISILYRKGTPIDSADDLAKQTKIEYGAVEDGSTMTFFKKSKISTYDKMWAFMSSRRQSVLVKSSEEGI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
SSSS

ST
SSS
BTTS

ST
BSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence QRVLTSDYALLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMK
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SSTT
TTSS
SS
TT
TTT
 ......
Sequence EKWWRG
Predicted secondary structure


SS confidence





Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D