Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5kowA_

Fold library idPDB HeaderMoleculeTitle
c5kowA_2.10PDB header: oxidoreductaseChain: A: PDB Molecule: pentachlorophenol 4-monooxygenase;


Added to library: Thu Feb 9 12:02:03 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HMIDVIIAGGGPTGLMLAGELRLHGVRTVVLEKEPTPNQHSRSRGLHARSIEVMDQRGLLERFLAHGEQF
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)



STTT

SSSS








TT
TS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RVGGFFAGLAAEWPADLDTAHSYVLAIPQVVTERLLTEHATELGAEIRRGCEVAGLDQDADGVTAELADG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

S
TTTT





TT
SSS

S

TT
T


SS
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TRLRARYLVGCDGGRSTVRRLLGVDFPGEPTRVETLLADVRIDVPVETLTAVVAEVRKTQLRFGAVPAGD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)



TT
T








SS
TT
TT

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GFFRLIVPAQGLSADRAAPTLDELKRCLHATAGTDFGVHSPRWLSRFGDATRLAERYRTGRVLLAGDAAH
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) S
SS

SS




S

TT



S
STT
GGGT
 .........290.........300.........310.........320.........330.........340.........350
Sequence IHPPTGGQGLNLGIQDAFNLGWKLAAAIGGWAPPDLLDSYHDERHPVAAEVLDNTRAQMTLLSLDPGPRA
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

TTT

T


TTTTT
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence VRRLMAELVEFPDVNRHLIEKITAIAVRYDLGDGHDLVGRRLRDIPLTEGRLYERMRGGRGLLLDRTGRL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TTSTTTT
B


S
SSTTBTBB



B
SSSBGGGG
TT


SS

 .........430.........440.........450.........460.........470....
Sequence SVSGWSDRVDHLADPGAALDVPAALLRPDGHVAWVGEDQDDLLAHLPRWFGAAT
Predicted secondary structure





























SS confidence





















































Known secondary structure (DSSP)

TT
TTT
TTSS
SSS
TTSB
S

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D