Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5kodA_

Fold library idPDB HeaderMoleculeTitle
c5kodA_2.20PDB header: ligaseChain: A: PDB Molecule: indole-3-acetic acid-amido synthetase gh3.5;


Added to library: Thu Feb 9 13:35:48 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DQKNKQKLQLIEELTSNADQVQRQVLEEILTRNADVEYLRRHDLNGRTDRETFKNIMPVITYEDIEPEIN
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
TSTTSTT
TT


S

B
 .........80.........90.........100.........110.........120.........130.........140
Sequence RIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSLLMPVMSQFVPGLENGKGMYFL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT

S
SS
SS
TTTTTTTSTTGGGS

 .........150.........160.........170.........180.........190.........200.........210
Sequence FIKSESKTPGGLPARPVLTSYYKSSHFKERPYDPYTNYTSPNETILCSDSYQSMYSQMLCGLCQHQEVLR
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)





TTS

TST



GGG
BSS
S
S
TGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence VGAVFASGFIRAIKFLEKHWIELVRDIRTGTLSSLITDPSVREAVAKILKPSPKLADFVEFECKKSSWQG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T


TT


STT



TSS

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence IITRLWPNTKYVDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPSMA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) STT



SGGGGGGTS




SS

S
TTS
GGG


TTSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence YFEFLPVHRQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRVTGFKNKAPQFSFICRKNVVLSIDS
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)






GGG

TT

TTS

STTTT

B
SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence DKTDEVELQNAVKNAVTHLVPFDASLSEYTSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLAVEE
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

B
GGGGGGT
SSSS

SSS


 .........500.........510.........520.........530.........540.........550.........560
Sequence SFNTVYRQGRVSDKSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYF
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S
TS

S



TTSS

STT



S



TT
 .........570...
Sequence SPKCPKWVPGHKQ
Predicted secondary structure












SS confidence












Known secondary structure (DSSP)
SS




SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D