Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5kkpA_

Fold library idPDB HeaderMoleculeTitle
c5kkpA_2.26PDB header: isomeraseChain: A: PDB Molecule: pseudouridylate synthase 7;


Added to library: Thu Feb 9 21:22:39 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISHLNDLSIPVPSEDIFTVLTAEEKQRTSV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)


TGGGT



S

S




BSSSSGGG
TTS
B















 .........80.........90.........100.........110.........120.........130.........140
Sequence AIEVIEDTKEKRTIIHQAIKSLFPGLETKTEDREGKKYIVAYHWPKSRGSYCHFVLYKENKDTXDAINVL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SS

S
SS
TT


TTS
SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence SKYLRVKPNIFSYXGTKDKRAITVQEIAVLKITAQRLAHLNKCLXNFKLGNFSYQKNPLKLGELQGNHFT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T

GGGS



SSST

GGGG
SSSS


TT
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence VVLRNITGTDDQVQQAXNSLKEIGFINYYGXQRFGAVPTYQVGRAILQNSWTEVXDLILKPRSGKGYLVK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) BS



T




GGGG



TT
S




 .........290.........300.........310.........320.........330.........340.........350
Sequence CREEWAKTKDPTAALRKLPVKRCVEGQLLRGLSKYGXKNIVSAFGIIPRNNRLXYIHSYQSYVWNNXVSK
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)

TT


SSS
TT
TTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence RIEDYGLKPVPGDLVLKGATATYIEEDDVNNYSIHDVVXPLPGFDVIYPKHKIQEAYREXLTADNLDIDN
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
SS

TT
TT

SSSGGG

GGG
SSS



SSTTT

TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence XRHKIRDYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFNTDVDNLEGKTPPVFASEGKYRALKXDFSLP
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


SSGGG



S

S
TTS
SS

T






S

S
 .........500.........
Sequence PSTYATXAIREVLKXDTSI
Predicted secondary structure







SS confidence


















Known secondary structure (DSSP) TT








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D