Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5khuA_

Fold library idPDB HeaderMoleculeTitle
c5khuA_4.80PDB header: cell cycleChain: A: PDB Molecule: anaphase-promoting complex subunit 1;


Added to library: Thu Feb 9 19:59:15 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MIAARDLQEFVPFGRDHCKKESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

S






TTGGGSSS

B






SS
SSS




SSS


SSSS





SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence PVQQALWCDFIISEVEKCICILQSSCINMHSIEGKDYIASLPFQVANVWPTKYGLLFERSPLPTMFSMLH
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
B





SSS

TTTTS

SS

S


B
SS
B
SSS
S
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PLDEITPLVCKVQYVVDHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEEQVPIVPELCIDHLWT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTS


BSSSSB


SSTTTTTTSS
B



S


SSSS







B
 .........220.........230.........240.........250.........260.........270.........280
Sequence ESQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESTQLIFGSVTNIPAKDAAPVEKIDTMLVLEGSGN
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)



S




TTS

TTTT
SSS
SS


SSS

TTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LVLYTGVVRVGKVFIPGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSSS
S


TTTT






S
S
TTTTSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence VQMLVKWYNVHSAPHSEWNLFVTCLMNMMGYQTDSSTLLTHIPAIFFVLHLVYEELKLNTLMGEGICSLV
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TSSS

STTTTB
SSS
B

S


TTTTSS

TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence ELLVQLARDLKLGPYVDHYYRDYPTLVFTSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIAL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTTT

TSSS


SSS



S







TTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence YILSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPASDWPEAVCLLIGRQDLSKQDDGM
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT
SSTT


SGGGSSS
TT
SSS


TSS








BT
 .........570.........580.........590.........600.........610.........620.........630
Sequence NDMNHEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGM
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TB

TT
SSS
TTTT


S
B






SS

TSS
TT
 .........640.........650.........660.........670.........680.........690.........700
Sequence FTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSA
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TTTT




SSS









SSS

SSSS
S


SS
STTSS
SS



 .........710.........720.........730.........740.........750.........760.........770
Sequence WIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T


S
SSTTGGGGS
S

TTTTTSS


S
 .........780.........790.........800.........810.........820.........830.........840
Sequence LLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT
SSS

GGG

TTS
SSS


TTT



SSSSS
SST
 .........850.........860.........870.........880.........890.........900.........910
Sequence AAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHEPSYQIKEGDTINVDVTCPGATLALAMIYLKTN
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTTTTSTTTTT
TTS
STTTT

S





SSS


S


STTTSSS

 .........920.........930.........940.........950.........960.........970.........980
Sequence NRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENLNLETLSQAHVY
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
SSS

SSTTS
S
STT

SSSS
TTTSS
STT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence IIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVLLSLAMVMAGSGNL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTS

TTTT
TT
TTTTTSSGGG

 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence KVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S
STTS
TTTTTTTT


SSS
SS

SSTT

SSS
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence QALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRY
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) GGGGGGGGSS

B


SSS
SB




TTTS
STT
B


GGG

SS
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence WELLIDLTQHLKSILSKDGVLYVKLRAGQALLSFAEYFCKQEILDLFSSVLYECVTQETPEMLPAYIAMD
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

SSSTTS




SSSS
TT


TTTTTTT
TT
 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence QAIRRLGRREMSETSELWQIKLVLEFFSSRSHQFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSLE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT



TTSS
SS



TTTTTTSTTTGGGGT

 .........1340.........1350.........1360.........1370....
Sequence ESQLSMLACFLVYHSVPAPAELLFKFKQLKMPVRALLRLAPLLL
Predicted secondary structure










SS confidence











































Known secondary structure (DSSP) STTTT
SS

SST

TTST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D