Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5khrO_

Fold library idPDB HeaderMoleculeTitle
c5khrO_6.10PDB header: cell cycleChain: O: PDB Molecule: anaphase-promoting complex subunit 5;


Added to library: Thu Feb 9 14:37:25 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIR
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)




T
STT

S
S




S
 .........80.........90.........100.........110.........120.........130.........140
Sequence IKLMAEGELKDMEQFFDDLSDSFEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKPLS
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S
T
TTS
SSSTS
BTTBS



 .........150.........160.........170.........180.........190.........200.........210
Sequence QKQAEFFLSQQAELLKNDETKALEPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYF
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) SS
SSSS


S

ST
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence DRLILRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQLSELIDISIA
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) T

SSTTTT
T
TTSS

SST
 .........290.........300.........310.........320.........330.........340.........350
Sequence QKTAIWRLYGRSTMALQQAQMLLSMNSLQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPN
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TTTT
TTS

TTTT

ST
S
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence SQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVH
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) STTT
STTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence CQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQA
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) T
TTSS
GGGGTT
TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence LSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERI
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) SS

STS

STTT
 .........570.........580.........590.........600...
Sequence RDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSVPLINHL
Predicted secondary structure









SS confidence










































Known secondary structure (DSSP) S
TTTGGG




TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D