Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5kdvA_

Fold library idPDB HeaderMoleculeTitle
c5kdvA_1.93PDB header: hydrolaseChain: A: PDB Molecule: metallopeptidase;


Added to library: Thu Feb 9 16:30:49 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MATQEEILDAALVSGDSSQLTDSHLVALRLQQQVERIRQTRTQLLDGLYQNLSQAYDPGAASMWVLPANP
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)





TT


TTS


B


SS




ST
 .........80.........90.........100.........110.........120.........130.........140
Sequence DNTLPFLIGDKGRVLASLSLEAGGRGLAYGTNVLTQLSGTNAAHAPLLKRAVQWLVNGDPGAATAKDFKV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT
TT


GGG

SS
GGGSTTTTTGGGSSTTS


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence SVVGVDKTAALNGLKSAGLQPADAACNALTDASCASTSKLLVLGNGASAASLSATVRARLQAGLPILFVH
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SS
TT



S
TTT

S
TT


TTT


 .........220.........230.........240.........250.........260.........270.........280
Sequence TNGWNQSSTGQQILAGLGLQEGPYGGNYWDKDRVPSSRTRTRSVELGGAYGQDPALVQQIVDGSWRTDYD
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
STTS

TT


TTTTTTT


B
TT

TT

T


S


 .........290.........300.........310.........320.........330.........340.........350
Sequence WSKCTSYVGRTTCDDVPGLSDFSKRVDVLKGALDAYNQKAQNLFALPGTTSLRLWLLWADAVRQNIRYPM
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GGG
TT
TTSTTTT

GGGSTT


S
B
 .........360.........370.........380.........390.........400.........410.........420
Sequence DKAADTARFQETFVADAIVGYVREAGAAQKELGSYAGQRQQSMPVSGSEETLTLTLPSAQGFTAIGRMAA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TTTTT



BSS




S

TTT





SS
SSSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence PGKRLSIRIEDAGQASLAVGLNTQRIGSTRLWNTRQYDRPRFLKSPDIKLQANQSVALVSPYGGLLQLVY
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TT



TT




GGGS
TTSTT
B
S
TT
S




TT



SS
 .........500.........510.........520.........530.........540.........550.........560
Sequence SGATPGQTVTVKVTGAASQPFLDIQPGEDSSQAIADFIQALDADKADWLEIRSGSVEVHAKVEKVRGSID
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S

TT
S
B




TTS

T

STT
 .........570.........580.........590.........600.........610.........620.........630
Sequence KDYGGDVQRFIRELNEVFIDDAYTLAGFAIPNQAKTPAIQQECAARGWDCDSETLHKLPGTQHINVDQYA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT
TTTT
B
TT



TT


S
B

S

SS
 .........640.........650.........660.........670.........680.........690.........700
Sequence QCGGGCSGNPYDQTWGLNPRGWGESHELGHNLQVNRLKVYGGRSGEISNQIFPLHKDWRVLREFGQNLDD
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) SSTT
SSSSS


TT
T

GGG
TTGGGGTTTGGG



ST
 .........710.........720.........730.........740.........750.........760.........770
Sequence TRVNYRNAYNLIVAGRAEADPLAGVNKRLWEDPGTYALNGERMAFYTQWVHYWADLKNDPLQGWDIWTLL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T
S
TTSSST


STTTTT
TT
TT
 .........780.........790.........800.........810.........820.........830.........840
Sequence YLHQRQVDKSDWDANKAALGYGTYAQRPGNSGDASSTDGNDNLLLGLSWLTQRDQRPTFALWGIRTSAAA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S
TTTTT
TT
SS






TT

TSB
TT



 .........850.........860.........870.........880.........890.
Sequence QAQVAAYGFAEQPAFFYANNRTNEYSTVKLLDMSQGSPAWPFPLEHHHHHH
Predicted secondary structure



























SS confidence


















































Known secondary structure (DSSP)


B



SSSS
GGG

SSS







TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D