Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5karA_

Fold library idPDB HeaderMoleculeTitle
c5karA_1.14PDB header: hydrolaseChain: A: PDB Molecule: acid sphingomyelinase-like phosphodiesterase 3b;


Added to library: Thu Feb 9 15:14:37 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LGRFWHISDLHLDPNYTVSKDPLQVCPSAGSQPVLNAGPWGDYLCDSPWALINSSLYAMKEIEPKPDFIL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)




B
TT



SSTTSS
GGGTTS


S
BTTB
TTS
B

SS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence WTGDDTPHVPNESLGEAAVLAIVERLTNLIKEVFPDTKVYAALGNHDFHPKNQFPAQSNRIYNQVAELWR
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



S
SS
GGGS
STT




TTSSSSTT


SS

G
 .........150.........160.........170.........180.........190.........200.........210
Sequence PWLSNESYALFKRGAFYSEKLPGPSRAGRVVVLNTNLYYSNNEQTAGMADPGEQFRWLGDVLSNASRDGE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) GGS
S


TTSSS

GGGGBTT
GGGTT
SSGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence MVYVIGHVPPGFFEKTQNKAWFRESFNEEYLKVIQKHHRVIAGQFFGHHHTDSFRMFYDNTGAPINVMFL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SS
SSB
TTSSS
BSB
GGG
SS
S

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence TPGVTPWKTTLPGVVDGANNPGIRIFEYDRATLNLKDLVTYFLNLRQANVQETPRWEQEYRLTEAYQVPD
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


S






TT
SS





TTT



TTSSS


T
SS
 .........360.........370.........380.........390.........400.........410..
Sequence ASVSSMHTALTRIASEPHILQRYYVYNSVSYNHLTCEDSCRIEHVCAIQHVAFNTYATCLHG
Predicted secondary structure



















SS confidence





























































Known secondary structure (DSSP) SS
TTTS

S




ST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D