Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5k9hA_

Fold library idPDB HeaderMoleculeTitle
c5k9hA_2.03PDB header: hydrolaseChain: A: PDB Molecule: 0940_gh29;


Added to library: Thu Feb 9 11:31:18 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPCGPVPTENQLRWQDMEMYAFIHYSLNTYTDEEWGYGNEDPQLFNPSSLDCRQWARVCKQAGMRGIIFT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


S



TT


SGGGTTT
SS

S


GGG


SS

TT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence AKHHCGFCMWPSAYTEYSVKNSPWKNGKGDVVRELADACREEGLKFAVYLSPWDRNHPAYGQPAYVAYFR
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TT

BSS

SS
SSBGGGSTGGGGT

T

SS
SS
TTTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence NQLRELLTNYGEIFEVWFDGANGGDGWYGGANETRKIDRTTYYQWPETYKMIRQLQPNCLIWNDGSDRGD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) SSS

S




SB

GGGT

B



TTTTT

TT

SSS

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence LRWVGTEAGNVGETNWSLLNHDGEVEWHMLHYGLENGDSWVPGETNTSIRPGWFYHDTENEHVKSLSKLM
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP) B
S
SSS


SS

S
SSS




TT
S

SSSSSS

GGGGGG


 .........290.........300.........310.........320.........330.........340.........350
Sequence DTYYKSVGRNSTLLLNFPIAPNGRIHPNDSLRGIAFKKMIGEVFRKNLAEKARTQTKGDETVIDFGKPTT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTTTBT


B
TTSSB
TS

TTTTSTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence FNRFLAEEDIRYGQRVKKFLLEAEINGQWQQLKDALVENGDGLTTIGHRRIICFPTVNATKLRFTVVNTK
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
GGG


TT

TT
SSS





TT
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence CEPFIKKLGVYLAPELTADIPDAGEKKSSNLHLFFSSPTQMMIDWETEQTITSFRYLPPQESKDGTVTHY
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SS







TTSTT



TTTTSTT

SS

TT


S
 .........500.........510.........520.........530.........540.........550....
Sequence TLWASTDWSNWTKLASGEFSNVVNNPIWQTIKFQPVRAKILKLDADRLATGNRMAYGDVEVNLK
Predicted secondary structure





















SS confidence































































Known secondary structure (DSSP) SSSS







TTTTT




S

TT
SS


S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D