Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5k8kA_

Fold library idPDB HeaderMoleculeTitle
c5k8kA_2.55PDB header: hydrolaseChain: A: PDB Molecule: udp-2,3-diacylglucosamine hydrolase;


Added to library: Thu Feb 9 15:38:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XKHSYFISDLHLSETQPELTALFVDFXQNLAPQAERLYILGDLFDFWIGDDEQSALIQQVKDLIKFVSDQ
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)





BBTTBTGGG
SS

BS



TT


T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GVQCYFQHGNRDFLIGERFSKETGAQLLPDYQLITLYDKKILLCHGDTLCIDDEAYQQFRRRVHQKWLQR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T


SSSTT




STT
SGGG
TT
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence LFLCLPLKVRVIIAEKIRAKSNQDKQAKSQEIXDVNQAFTAEKVQEFGVNLLIHGHTHREAIHQQEEFTR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
TS
SGGGS

T
S
SS



SS
 .........220.........230.......
Sequence IVLGDWRKNYASILKXDESGEFGFIKD
Predicted secondary structure













SS confidence


























Known secondary structure (DSSP)



BTTB


TTS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D