Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5k7lA_

Fold library idPDB HeaderMoleculeTitle
c5k7lA_3.78PDB header: metal transport/calcium binding proteinChain: A: PDB Molecule: potassium voltage-gated channel subfamily h member 1;


Added to library: Thu Feb 9 11:23:44 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)



B


SS
SSSTT
B
T

TTSBTT
STT

SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDSCKGWG
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) T



TT




TTSS


B
TTTS



SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

TTSSSTTTSS
T
STT

B




TT


SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence WDWIILILTFYTAILVPYNVSFKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRM
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)


S
SS
B

SS
S
B

 .........290.........300.........310.........320.........330.........340.........350
Sequence NYLKTWFVIDLLSCLPYDVINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVF
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TT




GGGGGGGGGGGGSS
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence GLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLALDIGTPYQFNKWEGGPSKNSVYISSLYFTMTSL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T
STT


TT
SS


B



B

S
 .........430.........440.........450.........460.........470.........480.........490
Sequence TSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKG
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) T



SS


STT

 .........500.........510.........520.........530.........540.........550.........560
Sequence LSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVH
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) SS

S
TSSSSSS

B

 .........570.........580.........590.........600.........610.........620.........630
Sequence CAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCANVRALTYCDLHV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TT

SB
TTS
S
SSSS
TT


S


SSSS
 .........640.........650.........660.........670.........680.........690.........700
Sequence IKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRLPPDHPVRRLFQRFRQQK
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) S


SSSS





TT

TT
 .
Sequence E
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D