Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5k5sA_

Fold library idPDB HeaderMoleculeTitle
c5k5sA_2.60PDB header: signaling proteinChain: A: PDB Molecule: extracellular calcium-sensing receptor;


Added to library: Thu Feb 9 11:15:45 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLP
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)


SS

S
SBS
B
S





S





B
SB

SSSST
 .........80.........90.........100.........110.........120.........130.........140
Sequence NLTLGYRIFDTCNTVSKALEATLSFVAQNKIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T


TT
TTTT





SSTT

SS


GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence SNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELIS
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) G
TTT
TTSS

TTT

SSTTTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence QYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT

T





TT

S

TTTTT
TTT

GGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence GGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHPLCTGDENINSVETPYIDYTHLRIS
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT


B

TTT

TTT
SSBTTTT





S


SSSS

TTT

S
BS
 .........360.........370.........380.........390.........400.........410.........420
Sequence YNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLQFTNNMGEQVTFDECGDLVG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T

TT

SSGGG



GGG

T

TTS


TTS



 .........430.........440.........450.........460.........470.........480.........490
Sequence NYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

TTT
S
TTS
TTSS
GGG

BTTTB
S




SS



TT
TT
 .........500.........510.........520.........530..
Sequence EPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCW
Predicted secondary structure





























SS confidence









































Known secondary structure (DSSP) S
TT


TT

STT
SS


TT



TTSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D