Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5k4pA_

Fold library idPDB HeaderMoleculeTitle
c5k4pA_1.32PDB header: transferaseChain: A: PDB Molecule: probable phosphatidylethanolamine transferase mcr-1;


Added to library: Thu Feb 9 19:42:03 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSAYS
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)

B
S
TT
SS
TTTS


S

GGGSGGGT
SS
S
TSTTS

S




 .........80.........90.........100.........110.........120.........130.........140
Sequence VPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNT
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) T
SS

GGGGGGB

TT
SSS

TTTTTTS
GGG
SSTTT
S

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence NPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLI
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) STT



GGGGGTTTTTS


TT
SS
GGGGS
GGG

S
S



S
GGGS
 .........220.........230.........240.........250.........260.........270.........280
Sequence NAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTTTTSS


SGGG
S


TTT

GGGTB

 .........290.........300.........310.........320...
Sequence DKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIR
Predicted secondary structure






















SS confidence










































Known secondary structure (DSSP)
GGG


B

TT

GGGTT
GGGTT


SB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D