Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5k3jA_

Fold library idPDB HeaderMoleculeTitle
c5k3jA_2.68PDB header: oxidoreductaseChain: A: PDB Molecule: acyl-coenzyme a oxidase;


Added to library: Thu Feb 9 14:55:26 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NRSIRDGDNPELLEERRMATFDTDKMAAVIYGSEEFARRRREITDAVSKIPELADIKPYPFLTREEKVTE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TT

TT

TT

S
TS
TT
GGGS
SS
GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence GTRKISILTKYLNQLIDRDNEEESLHLHREVIGYEGHPFALHDALFIPTLQSQASDEQQEKWLERARRRE
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TS
TT
T
SS

TTTS
TTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence IIGCYAQTELGHGSNLRNLETTAVYDIASQEFVLHTPTTTALKWWPGALGKSCNYALVVAELIIKRNNYG
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) S




BSS
SS
GGG


TTTT

SSTTSTTTTT
SSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PHFFMVQLRDEKTHIPLKGVTVGDIGPKMNFNAADNGYLGLNNLRVPRTNLLMRHCKVEADGTYVKPPHA
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
B
TTT

B
TT



SS
TTS
SSGGGB

SS

TT



SST
 .........290.........300.........310.........320.........330.........340.........350
Sequence KIGYSGMVKIRSQMAMEQGLFLAHALTIAARYSAVRRQGHLDDKQVEVKVLDYQTQQHRLFPSLARAYAF
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TGGGTT
B
S

S

SS

BGGGSTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence IFTGFETIHLYSQLLKDVDMGNTSGMADLHALTSGLKSVVAHETGEGIEQARMACGGHGYSMASYISVVY
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTTTTTTSSS

STTTTGGGGGSTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence GIAIGGCTYAGENMVMLLQLARYLVKSVELIKAGKAKKLGPVASYLADKSDETDLTSLNGYVKMFENMAR
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) GGGTTTS
TTTTTT
GGG

TTTGGGTS


S


SSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence RQAWKATEKFLKLMESGESREVAWNKSAVELTRASRLHTRLFIIEAFMRRVSRIEDIPVKEVLTDLLHLH
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TT

TTT
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence VNYELLDVATYALEFMSFTQLDYVRDQLYLYLEKIRPNAVSLVDSFQISDMQLRSVLGRRDGHVYENLFK
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTSS

SGGGTT




STT
SS

 .........640.........650.........660..
Sequence WAKSSPLNNADVLPSVEKYLKPMMEKAKLAAA
Predicted secondary structure
















SS confidence































Known secondary structure (DSSP) SGGGG
SS
TS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D