Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5k26A_

Fold library idPDB HeaderMoleculeTitle
c5k26A_1.20PDB header: transferaseChain: A: PDB Molecule: mitogen-activated protein kinase kinase kinase 11,chimera


Added to library: Sat Dec 16 08:26:13 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGAIRINP
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


SS
B

SSTTB

B
TT
S

SSGGGTTTTGGGSSSSS
T
 .......
Sequence NGTWSRQ
Predicted secondary structure






SS confidence






Known secondary structure (DSSP) TS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D