Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jzjB_

Fold library idPDB HeaderMoleculeTitle
c5jzjB_1.71PDB header: transferaseChain: B: PDB Molecule: serine/threonine-protein kinase dclk1;


Added to library: Thu Feb 9 17:18:32 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPNIVLL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


SSTTT



B
SSS
B


STT


TTB

 .........80.........90.........100.........110.........120.........130.........140
Sequence IEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SS

TT
B
S

TT



SGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence HQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFREVL
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
TTS



TT

SS
B



S
GGG

TS
B
TTSS
S


 .........220.........230.........240.........250.........260.
Sequence FDQILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVN
Predicted secondary structure


























SS confidence


















































Known secondary structure (DSSP) T




TTTTTTS
T
SSTTTS

SGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D