Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jvkB_

Fold library idPDB HeaderMoleculeTitle
c5jvkB_2.50PDB header: hydrolaseChain: B: PDB Molecule: uncharacterized protein;


Added to library: Thu Feb 9 15:16:45 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KIQLNPVLVSTDIGKKNVAKNLGEGNMRLTGKLVRYGDNLTFSGVANAGKELVIDVTELGYYTLELTLAD
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

S

SS


TTTTT


TTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NENIIQTAVVNYAVVPEIIDEERPLDMGVCVHPPKDNDYSKTFRLIRMAGFTRIRTDLAWEHVEPAKGKY
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT



GGGS
TT



TT

TT
S
SBTTB
 .........150.........160.........170.........180.........190.........200.........210
Sequence VMPEHMYQFVSASEKEGIKPLIVFGYANAIAYPNGFPTIPFPTTEESRLGCANALAYAVKEMGNRVTEWE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


TT



TTT
TTS
SSSSS

SGGG

 .........220.........230.........240.........250.........260.........270.........280
Sequence LWNEPNYADPVKDYLPLLKVVYPTVKKVNPDITLISGGGSGAGGGPGGAFIIPVLDAGGVDFQDGYSIHP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
S


SS
TTTT
TTSSSS
SGGGSTT
TTTT
GGG
S

 .........290.........300.........310.........320.........330.........340.........350
Sequence YMAPNTPDFGYAGTGGPIPAVNIPTVWPYLKKISEENLRSDKKELSVWVTEIGWNSTTNLDIEQAAYLAR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

TTS
TTT

SSSS
SSS

TTS





TTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence TYLLSRRHYMSPGVFWYDFQNDGDTPDNIEHNFGLLRSDFSPKPSYQAAAVVASLLKNYTFQETLLDGVN
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) T


S
S
SB
S
S
TT
GGGS

SB
TTS
B
TT

SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence KVLAFGQDGETTFYTAWTTKAEGTTIRVKAPTDVDKLRLIDWQGCEMPLTVDNGYLVLNLSILPQYLVVK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTSSTT

SS
TTT
TTS



BSSS
SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D