Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5juyB_

Fold library idPDB HeaderMoleculeTitle
c5juyB_4.10PDB header: apoptosisChain: B: PDB Molecule: apoptotic protease-activating factor 1;


Added to library: Fri Feb 10 01:50:08 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMILKKDNDSYVS
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)

T

GGGTTTSS
TSSSTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence FYNALLHEGYKDLAALLHDGIPVVSGITSYVRTVLCEGGVPQRPVVFVTRKKLVNAIQQKLSKLKGEPGW
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
TT







TTTTT




SS



T
SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VTIHGMAGCGKSVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLN
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
STTSS
TTTT

TT


S


SS

S
S



S
 .........220.........230.........240.........250.........260.........270.........280
Sequence IEEAKDRLRILMLRKHPRSLLILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TS
S




T
SS
S
SSTTTT

S


B







 .........290.........300.........310.........320.........330.........340.........350
Sequence KGLEILSLFVNMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSY
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) T

GGGS
TTT
SS

TTS


TT



SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence DYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVNKSLLFCDRN
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SSSSTS
TTTGGGG

TT

B
STS
TTSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence GKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYHMASAKMHKE
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) SSS



TTSBTTB

TTSSSTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence LCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPFPNIVQLGLC
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) S
T
TTTS
TTTTTSSS


TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence EPETSEVYQQAKLQAKQEVDNGMLYLEWINKKNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
TTSS
SSTT


B
SGGGTSS


S


SS


B
TTS
TTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence QVFKAETGEKLLEIKAHEDEVLCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SSS



SS



SSSSTTS
TTT
S


SS







S
 .........710.........720.........730.........740.........750.........760.........770
Sequence SSHHLLLATGSSDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SSS


TTS
TTSSS


SS

S
SSTT
TTSTTT
S
 .........780.........790.........800.........810.........820.........830.........840
Sequence SINVKQFFLNEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHHSTIQYCDFSPQNHL
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


S









TTSS
TT
TTT
S

STT




SSTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence AVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTSSDDQTIRLWETKKVCKNSAVMLKQ
Predicted secondary structure
































































SS confidence





































































Known secondary structure (DSSP)
SSS
TTT
S


SS
TTTTTTS
T





 .........920.........930.........940.........950.........960.........970.........980
Sequence EVDVVFQENEVMVLAVDHIRRLQLINGRTGQIDYLTEAQVSCCCLSPHLQYIAFGDENGAIEILELVNNR
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) TTSSSS
TTS



S

S
TTSS
TTSSSS
TT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence IFQSRFQHKKTVWHIQFTADEKTLISSSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)




S


SSS
SSSSTTTT

SS



SSS

TT
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence GTVKVWNIITGNKEKDFVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S

SSS






SSS


SS
SSS
SS

SSSSS
S
S

S


 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence FSVDSTLLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTT


TT



SSSS






S
TT


SS







SSSSSSSS
 .........1200.........1210.........1220.........1230....
Sequence VTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
Predicted secondary structure

















SS confidence











































Known secondary structure (DSSP) SSS
SB

S

SSS





TTSSS
TT

B



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D