Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jtvA_

Fold library idPDB HeaderMoleculeTitle
c5jtvA_3.31PDB header: hydrolaseChain: A: PDB Molecule: ubiquitin carboxyl-terminal hydrolase 7;


Added to library: Thu Feb 9 11:25:43 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKK
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

SS


B


SS
T
TS

SS

TTT

SS
B

 .........80.........90.........100.........110.........120.........130.........140
Sequence LTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYY
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT

TTGGG



TTTSTTTT
SSSS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence DIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQN
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

TT

BS

GGG

STT

S


S
TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence IKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRC
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)




B

S
TTSBSS

SSS

TT
TTSSS

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence TKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKITDF
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TGGGT



SS
SGGGGGGGT



STTS
GGGS





 .........360.........370.........380.........390.........400.........410.........420
Sequence ENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDEL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
SB


TTS


BTT
BTTS


SSS


TT
TTSB
 .........430.........440.........450.........460.........470.........480.........490
Sequence LECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) GGGS


TT

GGGSS

TTT

SSSS

TT

 .........500.........510.........520.........530.........540.........550.........560
Sequence DIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAI
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)


TT
TT

SSS



GGGG


TT
SSS














SS



 ....
Sequence KIHN
Predicted secondary structure

SS confidence



Known secondary structure (DSSP)




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D