Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jr6B_

Fold library idPDB HeaderMoleculeTitle
c5jr6B_2.30PDB header: hydrolaseChain: B: PDB Molecule: peptidase, putative;


Added to library: Thu Feb 9 17:09:38 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VYILINSDEHNSEIINEKDKKIADGILIVRISRIDNRDEIFETIIAFDGKNTSVVFYEKLRKALLNAYPK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
S

TT

SS

GGG










SSSTT

TTT
BS


 .........80.........90.........100.........110.........120.........130.........140
Sequence IVEKIFLVLEKSLVYPVNNKTLYIHDRKYNGACAGEKIDKLKQSLMYDIKNVDNLLLSELDEIAYLLNLR
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


B

SS












SS
TT

SBS

T
 .........150.........160.........170.........180.........190.........200.........210
Sequence GYDYQYSPLFYSYLLFQFDRQDFSKIVFFTTVKNLPADVKNLLEINKVIVKEYEEIVPYLRDVVIPSIDF
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SSSSSS








GGG

TT
GGGTTSS



 .........220.........230.........240.........250.........260.........270.........280
Sequence KKYDISLSPYINLMIYKLFDRKNVLLQNSPVVKMKAVKNDVEIDNMKQAHILDGLALLQFFHWCEQKRKT
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

BS
TT
BTTS
GGG


TTTB

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence KELFNETEMSLRHKVDYFRSTKKNFIFPSFSTISASGPNAAVIHYECDKTNATIKPAIYLLDSGGQYLHG
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TGGGG
BTSTTSS

GGGGGSTT




S

B

SS
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence TTDVTRTTHFGEPTAEEKRIYTLVLKGHLRLRKVIFASYTNSSALDFIARENLFNNFMDYNHGTGHGVGL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

SS




TT
BTT


SS
S

S
 .........430.........440.........450.........460.........470.........480.........490
Sequence TLNVHEGGCSIGPVGGAPLKKNMVLSNEPGYYMKDKFGVRIENMQYVISKEITDTTEYLSFDDLTMYPYE
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) SS
SS
SSS

B

TTB

TTT
B
SS







 .........500.........510.........520.........530.........540.....
Sequence KKLLDFSLLTNQEIKELNEYHTTIRNTLLPLVKQSPQEYGESVEKYLIEITEPIA
Predicted secondary structure















SS confidence






















































Known secondary structure (DSSP) GGG

TTS


TTTS
TS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D