Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jp0A_

Fold library idPDB HeaderMoleculeTitle
c5jp0A_2.30PDB header: hydrolaseChain: A: PDB Molecule: beta-glucosidase bogh3b;


Added to library: Thu Feb 9 11:54:28 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SPVIPTDPAIETHIREWLQKMTLEQKIGQMCEITIDVVSDLETSRKKGFCLSEAMLDTVIGKYKVGSLLN
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

SS




TGGGGB
S

B
TTTT


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence VPLGVAQKKEKWAEAIKQIQEKSMKEIGIPCIYGVDQIHGTTYTLDGTMFPQGINMGATFNRELTRRGAK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
GGGS
B
TSS




SS
TTBTT





T
 .........150.........160.........170.........180.........190.........200.........210
Sequence ISAYETKAGCIPWTFAPVVDLGRDPRWARMWENYGEDCYVNAEMGVSAVKGFQGEDPNRIGEYNVAACMK
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTT




B





TT
TTGGGSS
S

S
TTS

TT

B
 .........220.........230.........240.........250.........260.........270.........280
Sequence HYMGYGVPVSGKDRTPSSISRSDMREKHFAPFLAAVRQGALSVMVNSGVDNGLPFHANRELLTEWLKEDL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTTT
BTTS
TTS
B


TTTTT


SSTTGGG





TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NWDGLIVTDWADINNLCTRDHIAATKKEAVKIVINAGIDMSMVPYEVSFCDYLKELVEEGEVSMERIDDA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T




TTTT
S
SST

B

S
TTSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence VARVLRLKYRLGLFDHPYWDIKKYDKFGSKEFAAVALQAAEESEVLLKNDGNILPIAKGKKILLTGPNAN
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTTTT
SS


TT
TTTT

GGG

S

TT

STTSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence SMRCLNGGWSYSWQGHVADEYAQAYHTIYEALCEKYGKENIIYEPGVTYASYKNDNWWEENKPETEKPVA
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)

SSSSSSSSTT
TTS


GGG

SS
B


STT
TT
B



T
 .........500.........510.........520.........530.........540.........550.........560
Sequence AAAQADIIITCIGENSYCETPGNLTDLTLSENQRNLVKALAATGKPIVLVLNQGRPRIINDIVPLAKAVV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) GGG
S




SGGG

S

B

TT



SS

B
TTTGGG
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence NIMLPSNYGGDALANLLAGDANFSGKMPFTYPRLINALATYDYKPCENMMDIQWPFGFGLSYTNYKYSNL
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

S
GGGTTSS





SS
SSTT



TT

GGGG



TT

B
SS
 .........640.........650.........660.........670.........680.........690.........700
Sequence KVNKPTFNADDELIFTVDVTNTGKVAGKESVLLFSKDLVASSTPDNIRLRNFEKVSLEPGETKTVTLKLK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S
S
TT

SSS
SS
SS


S

TT
 .........710.........720.........730.........740.....
Sequence GSDLAFVGYDGKWRLEKGDFKIKCGDQWMDIVCDQTKVWNTPNKN
Predicted secondary structure




















SS confidence












































Known secondary structure (DSSP) GGGG

TTS

STT
S


SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D