Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jozB_

Fold library idPDB HeaderMoleculeTitle
c5jozB_2.28PDB header: hydrolaseChain: B: PDB Molecule: non-reducing end alpha-l-arabinofuranosidase bogh43b;


Added to library: Thu Feb 9 15:00:22 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KTFRNPIITGMNPDPSICRVGDDFYLVTSTFEYFPGLPVYHSKDLVHWKLIGHALSRPENNPLMGCNAST
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
S
SB
SS

S
TT


BTSSSSSS

STTTS

TT

TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GGQYAPTLRYHDGTFYVIGTNYGGKGSQGVFYVTAKNPAGPWSDPVWVGNWYVDPSIEFIDGKMYFLSPD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S


TTS
TT

SSSTTS





S


SS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence NQGSFLLGVMDPETGTFVEALRKVASGLGGSSPEGPHFYKIGDYYYIMSAEGGTGYEHREVIQRSKSPWG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) SSS
TTT


S

SSSS
TTS
SSTT
SSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence PYEPSPVNPVLSNMNCPDHPFQAIGHADLVQLKDGSWWAVCLGIRPVNGKYQHLGRETFLAPVTWDADGW
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


TT

S
TT
TTSS

TTS


BTTTB

S


TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PKVGKDGVVQETYLFPNLPSHVWMEQPVRDDFDQETLGLDWTFIRNPAHSFWSLTEKPGSLRLKGTAINF
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) STTT



S

SS








S


SSS

TT
BSS

GGGSSSSTTS

BS

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence TTNDSPSFIGRRQAAFNLTASAKVNFIPKVENEEAGLVVRADDKNHYDLLITERNGQRVAMIRKTLKDKV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TSSS

S


SS


SSTT
TTTTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence VDTTCKELPATGEVILSITATETTYTFEIKAAHVSAILGTASTRDVSNEVVGGFTGVFIGMYASGNGQAN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

SSS

SSTTSGGGS
SS



TTS

 .........500....
Sequence TNPADFDWFDFRCL
Predicted secondary structure


SS confidence













Known secondary structure (DSSP) SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D