Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5joxA_

Fold library idPDB HeaderMoleculeTitle
c5joxA_1.80PDB header: hydrolaseChain: A: PDB Molecule: non-reducing end alpha-l-arabinofuranosidase bogh43a;


Added to library: Thu Feb 9 11:09:57 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HQGYSNPVIPGFHPDPSVCKAGDDYYLVNSSFQYFPGVPLFHSKDLVHWEQIGNCLTRPSQLDLTNANSG
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
S
SB
SS

S
TT


BTSSSSS


SGGG


TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SGIFAPTIRYNDGVFYMITTNVSGKGNFLVHTTDPRSEWSEPVWLEQGGIDPSLYFEDGKCFMVSNPDGY
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SSB


TTTTTTS
TTS





S

SS

TT
GGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence INLCEIDPMTGKQLSSSKRIWNGTGGRYAEGPHIYKKDGWYYLLISEGGTELGHKVTIARSRYIDGPYQG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTT

B
S



SS
SS
TTS
SSTT
SSTT


 .........220.........230.........240.........250.........260.........270.........280
Sequence NPANPILTHANESGQSSPIQGTGHADLVEGTDGSWWMVCLAYRIMPGTHHTLGRETYLAPVRWDKDAWPV
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
TT

SSSSGGGTT
S
TTS

BTTTB
SS
S

TTS

 .........290.........300.........310.........320.........330.........340.........350
Sequence VNSNGTISLKMDVPTLPQQEMKGRPERIDFKEGKLSPEWIHLQNPEAKNYIFTKDGKLRLIATPVTLSDW
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) TTTS


S
S








S
TTS


TT
BSS

GGG
TTS


S

TTSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence KSPTFVALRQEHFDMEASAPVVLQKAGVNDEAGISVFMEFHSHYDLFVRQDKDRKRSVGLRYKLGEITHY
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S




SSS

TT
TT
GGG
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence AKEVSLPTDGEVELVVKSDINYYYFGYKVNGIYHDLGKMNTRYLSTETAGGFTGVVLGLYITSASKDSKA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

SSS

SSTTSGGGS
SS




STT


 .........500..
Sequence YADFEYFKYKGK
Predicted secondary structure

SS confidence











Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D