Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jouA_

Fold library idPDB HeaderMoleculeTitle
c5jouA_1.50PDB header: hydrolaseChain: A: PDB Molecule: alpha-xylosidase bogh31a;


Added to library: Thu Feb 9 12:32:14 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSSHHHHFQGPASNKVYEKTGDSVIVKVQHKETGGPRLVRLQVMGDKLIHVSATADSKFADPQSLIVVPQ
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)




S
GGGSS
SS
SS

TTS
STTSSSS





SS



 .........80.........90.........100.........110.........120.........130.........140
Sequence KKQTSFAVVQNGDTITVSTEEVKASVLASTGEVWFTDKNGELILQENKGGGKTFTPIEVEGTKGYTVCQV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SS



TT
SSTTT

TT

B
TT

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence FESPEDEAFYGLGQHQADEFNYKGKNEELFQYNTKVSVPFVVSNKNYGILLDSYSFCRFGNPNDYSQLNR
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)


TT


SS




TT



BTTBTTT


S
S

S

 .........220.........230.........240.........250.........260.........270.........280
Sequence IFKLYDKTGQEGALTGTYVPKKGETLVRREDSIYFENLKTIENLPKKLPLMGAKVTYEGEIEPAQTGEFK
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)
TTS
BT

SSS

S


STTGGGGS
TT


TT
SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence FILYYAGYVKVYLNNEPVVPERWRTAWNPNSYKFAAHLEAGKRVPLKIEWQPDGGQSYCGLRALTPVNPE
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP)
TT
TTS

TT



SSS





 .........360.........370.........380.........390.........400.........410.........420
Sequence EQGKQSWWSEMTKQLDYYFMAGENMDDVISGYRSLTGKSPVMPKWAMGFWQSREKYNTQEEMLGALKGFR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TSSS
SS






GGGGS

TT

S
 .........430.........440.........450.........460.........470.........480.........490
Sequence DRKIPLDNIVLDWNHWPENAWGSHEFDKARFPDPKAMVDSIHAMHARMMISVWPKFYVTTEHFKEFDENG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T




S

S
TT
TTS



TTT
S
TT

STTSTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence WMYQQSVKDSLKDWVGPGYHYGFYDAYDPDARKLFWKQMYEHYYPLGIDAWWMDASEPNVRDCTDLEYRK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
B

TT
B
SSTT

BB
TTSTGGGT



TTT
SSTT

 .........570.........580.........590.........600.........610.........620.........630
Sequence ALCGPTALGSSTEFFNAYALMNAEAIYDGQRGVDNNKRVFLLTRSGFAGLQRYSTATWSGDIGTRWEDMK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) T

BTTB
TTTS
S

TTB


SS

TTGGGGS

S
BS
 .........640.........650.........660.........670.........680.........690.........700
Sequence AQISAGLNFAMSGIPYWTMDIGGFCVENRYVAGQKQWNATKTENADYKEWRELNTRWYQFGAFVPLYRAH
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT




BT
SB





TTSSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence GQYPFREIWEIAPEGHPAYQSVVYYTKLRYNMMPYIYSLAGMTWFDDYTIMRPLVMDFTADAEVNDIGDQ
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SSS

SS
TTSTS


S

TT
GGGTT

S
 .........780.........790.........800.........810.........820.........830.........840
Sequence FMFGPSFMVSPVYRYGDRSREIYFPQAEGWYDFYSGKFQAGGERKVIEAPYERIPLYVRAGAIIPFGDDI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTT



STT
S
SSS
TTT


SS

TT


TT




 .........850.........860.........870.........880.........890.........900.........910
Sequence QYTDEKPAEHIRLYIYQGADGEFTLYEDEGVNYNYEQGMYAMIPMKYDEATKTLVIGERQGEFPGMLKER
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SSTTSS



SS


SSBSGGGGT

TTTT


B


TT

SS
 .........920.........930.........940.....
Sequence TFTVVTVNKEKAQPFDLNAKGVTVKYNGSEQTLKL
Predicted secondary structure











SS confidence


































Known secondary structure (DSSP) BTTB




TT


SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D